Prolactin
Product Sizes
10 ug
£286.00
500-088-10UG
50 ug
£403.00
500-088-50UG
About this Product
- SKU:
- 500-088
- Additional Names:
- Mammotropin, Luterotropic hormone, Lutetropin
- translate.label.attr.clone:
- Rabbit IgG
- Extra Details:
- Recombinant rabbit prolactin, one polypeptide chain containing 199 amino and an additional Ala at N-terminus acids and having a molecular mass of ~ 23 kDa, was purified by proprietary chromatographic techniques (unpublished data).
- Formulation:
- lyophilized
- Host:
- Rabbit
- Molecular Weight:
- 23.0 kDa
- Purity:
- > 98% by SDS-PAGE & HPLC analyses
- Reactivities:
- Rabbit
- Sequence:
- APICPSGAVNCQVSLRDLFDRAVILSHHIHKLSSEMFNEFDKRYTQGRGFITKAINSCHTSSLSTPEDKEQAQQIHHEDLLNMVLRVLPSWNDPLYHLVTEVRGMQEAPDAILSKAIEIEEQNRRLLEGMEKIVGQVHPGIKENEIYSVWSGLPSLQMADEDARLFAFYNLLHCLRRDSHKIDNYLKLLKCRIIYDSNC
- Shipping Conditions:
- Ambient
- Storage Conditions:
- Room Temperature
- Supplier:
- ReliaTech
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
