Prolactin antagonist (G129R)
Product Sizes
10 ug
£405.00
500-086-10UG
50 ug
£674.00
500-086-50UG
About this Product
- SKU:
- 500-086
- Additional Names:
- Mammotropin, Luterotropic hormone, Lutetropin
- translate.label.attr.clone:
- (#2F66)
- Extra Details:
- Recombinant ovine prolactin, G129R mutein is one polypeptide chain containing 199 amino and an additional Ala at N-terminus acids and having a molecular mass of ~ 23 kDa, was purified by proprietary chromatographic techniques (no published information). It is available in two forms: as full size protein and it its DEL 9 aa truncated form from its N-terminus which has higher inhibitory activity.
- Formulation:
- lyophilized
- Host:
- Mouse
- Molecular Weight:
- 23.0 kDa
- Purity:
- > 99% by SDS-PAGE & HPLC analyses
- Reactivities:
- Sheep
- Sequence:
- ATPVCPNGPGNCQVSLRDLFDRAVMVSHYIHNLSSEMFNEFDKRYAQGKGFITMALNSCHTSSLPTPEDKEQAQQTHHEVLMSLILGLLRSWNDPLYHLVTEVRGMKGVPDAILSRAIEIEEENKRLLERMEMIFGQVIPGAKETEPYPVWSGLPSLQTKDEDARHSAFYNLLHCLRRDSSKIDTYLKLLNCRIIYNNNC
- Shipping Conditions:
- Ambient
- Storage Conditions:
- Room Temperature
- Supplier:
- ReliaTech
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins