Prolactin
Product Sizes
1000 ug
£3791.00
500-085-L1000-1000UG
About this Product
- SKU:
- 500-085-L1000
- Additional Names:
- Mammotropin, Luterotropic hormone, Lutetropin
- Extra Details:
- Recombinant ovine prolactin, one polypeptide chain containing 199 amino and an additional Ala at N-terminus acids and having a molecular mass of ~ 23 kDa, was purified by proprietary chromatographic techniques (see Leibovich et al., Protein Expr Purif. 2001 22:489-96).
- Formulation:
- lyophilized
- Molecular Weight:
- 23.0 kDa
- Purity:
- > 99% by SDS-PAGE & HPLC analyses
- Reactivities:
- Sheep
- Sequence:
- ATPVCPNGPGNCQVSLRDLFDRAVMVSHYIHNLSSEMFNEFDKRYAQGKGFITMALNSCHTSSLPTPEDKEQAQQTHHEVLMSLILGLLRSWNDPLYHLVTEVRGMKGVPDAILSRAIEIEEENKRLLEGMEMIFGQVIPGAKETEPYPVWSGLPSLQTKDEDARHSAFYNLLHCLRRDSSKIDTYLKLLNCRIIYNNNC
- Shipping Conditions:
- Blue Ice
- Supplier:
- ReliaTech
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
