Leptin super antagonist (mutant D23L/L39A/D40A/F41A)
Product Sizes
1000 ug
£2809.00
500-068-L1000-1000UG
About this Product
- SKU:
- 500-068-L1000
- Additional Names:
- Lep; ob; obese
- Extra Details:
- Recombinant ovine leptin, one polypeptide chain containing 146 amino and additional Ala at N-terminus acids and having a molecular mass of ~ 16 kDa, was mutated, resulting in D23L/L39A/D40A/F41A mutant termed recombinant super active ovine leptin antagonist that was purified by proprietary chromatographic techniques.
- Formulation:
- lyophilized
- Molecular Weight:
- 16.0 kDa
- Purity:
- > 98.0% as determined by Gel filtration and SDS-PAGE gel.
- Reactivities:
- Sheep
- Sequence:
- AVPIRKVQDDTKTLIKTIVTRINLISHTQSVSSKQRVTGAAAAPGLHPLLSLSKMDQTLAIYQQILASLPSRNVIQISNDLENLRDLLHLLAASKSCPLPQVRALESLESLGVVLEASLYSTEVVALSRLQGSLQDMLRQLDLSPG
- Shipping Conditions:
- Blue Ice
- Supplier:
- ReliaTech
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
