Leptin antagonist (mutant L39A/D40A/F41A)
Product Sizes
10 ug
£286.00
500-065-10UG
50 ug
£403.00
500-065-50UG
About this Product
- SKU:
- 500-065
- Additional Names:
- Lep; ob; obese
- translate.label.attr.clone:
- Rabbit IgG
- Extra Details:
- Recombinant ovine leptin, one polypeptide chain containing 146 amino and additional Ala at N-terminus acids and having a molecular mass of ~ 16 kDa, oLEP was mutated, resulting in L39A/D40A/F41A mutant was purified by proprietary chromatographic techniques. Preparation of recombinant leptin antagonists was recently published - Niv-Spector et al, Biochem. J 291;221-230 (2005).
- Formulation:
- lyophilized
- Host:
- Rabbit
- Molecular Weight:
- 16.0 kDa
- Purity:
- > 98.0% as determined by Gel filtration and SDS-PAGE gel.
- Reactivities:
- Sheep
- Sequence:
- AVPIRKVQDDTKTLIKTIVTRINDISHTQSVSSKQRVTGAAAIPGLHPLLSLSKMDQTLAIYQQILASLPSRNVIQISNDLENLRDLLHLLAASKSCPLPQVRALESLESLGVVLEASLYSTEVVALSRLQGSLQDMLRQLDLSPG
- Shipping Conditions:
- Ambient
- Storage Conditions:
- Room Temperature
- Supplier:
- ReliaTech
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
