Leptin super antagonist (mutant D23L/L39A/D40A/F41A)
Product Sizes
50 ug
£278.00
500-055-50UG
100 ug
£405.00
500-055-100UG
About this Product
- SKU:
- 500-055
- Additional Names:
- Lep; ob; obese
- Extra Details:
- Recombinant super rat leptin antagonist is one polypeptide chain containing 146 amino. Super rat leptin antagonist (SRLA) was initially mutated, resulting in D23L/L39A/D40A/F41A super rat leptin antagonist that was purified by proprietary chromatographic techniques. The procedure was similar to that described in in Shpilman at al., J. Biol. Chem. 286:4439-42 (2011) for mouse super leptin antagonist.
- Formulation:
- lyophilized
- Molecular Weight:
- 16.0 kDa
- Purity:
- > 98.0% as determined by Gel filtration and SDS-PAGE gel.
- Reactivities:
- Rat
- Sequence:
- AVPIHKVQDDTKTLIKTIVTRINLISHTQSVSARQRVTGAAAIPGLHPILSLSKMDQTLAVYQQILTSLPSQNVLQIAHDLENLRDLLHLLAFSKSCSLPQTRGLQKPESLDGVLEASLYSTEVVALSRLQGSLQDILQQLDLSPEC
- Shipping Conditions:
- Ambient
- Storage Conditions:
- Room Temperature
- Supplier:
- ReliaTech
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins