Leptin pegylated antagonist (mutant L39A/D40A/F41A)
Product Sizes
50 ug
£405.00
500-054-50UG
100 ug
£674.00
500-054-100UG
About this Product
- SKU:
- 500-054
- Additional Names:
- Lep; ob; obese
- Extra Details:
- Mono-pegylated (with 20 kDa PEG) recombinant rat leptin antagonist is one polypeptide chain containing 146 amino, an additional Ala at N-terminus and one molecule of PEG 20 kDa at its N-terminus, having an expected molecular mass of ~ 35.6 kDa as determined by MS. However due to enlarged hydrodymanic volume pegylated recombinant rat leptin antagonist runs on the SDS-PAGE as 48 kDa protein and on gel-filtration Superdex 200 column as over 100 kDa protein. The half-life of recombinant rat leptin antagonist in circulation after SC injection was over 20 hours. Recombinant rat leptin was initially mutated, resulting in L39A/D40A/F41A mutant that was purified by proprietary chromatographic techniques according to Salomon et al (2006) Protein Expression and Purification 47, 128-136.
- Formulation:
- lyophilized
- Molecular Weight:
- 35.6 kDa
- Purity:
- > 99.0% as determined by Gel filtration and SDS-PAGE gel.
- Reactivities:
- Rat
- Sequence:
- AVPIHKVQDDTKTLIKTIVTRINDISHTQSVSARQRVTGAAAIPGLHPILSLSKMDQTLAVYQQILTSLPSQNVLQIAHDLENLRDLLHLLAFSKSCSLPQTRGLQKPESLDGVLEASLYSTEVVALSRLQGSLQDILQQLDLSPEC
- Shipping Conditions:
- Ambient
- Storage Conditions:
- Room Temperature
- Supplier:
- ReliaTech
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
