Leptin pegylated super antagonist (mutant D23L/L39A/D40A/F41A)
Product Sizes
50 ug
£404.71
500-051-50UG
100 ug
£674.12
500-051-100UG
About this Product
- SKU:
- 500-051
- Additional Names:
- Lep; ob; obese
- translate.label.attr.clone:
- (#12G3)
- Extra Details:
- Mono-pegylated mouse super leptin antagonist (with 20 kDa PEG) is one polypeptide chain containing 146 amino, an additional Ala at N-terminus and one molecule of PEG 20 kDa at its N-terminus, having an expected molecular mass of ~ 35.6 kDa as determined by MS. However due to enlarged hydrodymanic volume pegylated recombinant super mouse leptin antagonist runs on the SDS-PAGE as a 55 kDa protein and in gel-filtration on Superdex 200 as over 200 kDa protein. Pegylated recombinant super mouse leptin antagonist half-life in circulation after SC injection was over 20 hours. Super mouse leptin antagonist (SMLA) was initially mutated, resulting in D23L/L39A/D40A/F41A mutant that was purified by proprietary chromatographic techniques. Its pegylation is similar to that described in Elinav et al. Endocrinology 150:3083-91 (2009) for pegylated recombinant mouse leptin antagonist.
- Formulation:
- lyophilized
- Host:
- Insect/Arthropod
- Molecular Weight:
- 35.6 KkDa
- Purity:
- > 95.0% as determined by Gel filtration and SDS-PAGE gel.
- Reactivities:
- Mouse
- Sequence:
- AVPIQKVQDDTKTLIKTIVTRINLISHTQSVSAKQRVTGAAAIPGLHPILSLSKMDQTLAVYQQVLTSLPSQNVLQIANDLENLRDLLHLLAFSKSCSLPQTSGLQKPESLDGVLEASLYSTEVVALSRLQGSLQDILQQLDVSPEC
- Shipping Conditions:
- Ambient
- Storage Conditions:
- Room Temperature
- Supplier:
- ReliaTech
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins