Leptin antagonist (mutant L39A/D40A/F41A/I42A)
Product Sizes
50 ug
£277.65
500-043-50UG
100 ug
£367.06
500-043-100UG
About this Product
- SKU:
- 500-043
- Additional Names:
- Lep; ob; obese
- Extra Details:
- Recombinant human leptin is one polypeptide chain containing 146 amino and additional Ala at N-terminus acids and having a molecular mass of ~ 16 kDa. Human leptin was mutated, resulting in L39A/D40A/F41A/I42A mutant which is leptin antagonist. It was purified by proprietary chromatographic techniques. Preparation of leptin antagonists was published (Niv-Spector et al, Biochem. J 291;221-230 (2005).
- Formulation:
- lyophilized
- Host:
- E. coli
- Molecular Weight:
- 16.0 kDa
- Purity:
- > 98.0% as determined by Gel filtration and SDS-PAGE gel.
- Reactivities:
- Human
- Sequence:
- AVPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGAAAAPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC
- Shipping Conditions:
- Ambient
- Storage Conditions:
- Room Temperature
- Supplier:
- ReliaTech
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins