Leptin, Pegylated
Product Sizes
100 ug
£1766.00
500-038-L100-100UG
About this Product
- SKU:
- 500-038-L100
- Additional Names:
- Lep; ob; obese
- Extra Details:
- Mono-pegylated (with 20 kDa PEG) recombinant human leptin is an one polypeptide chain containing 146 amino, an additional Ala at N-terminus and one molecule of PEG 20 kDa at its N-terminus, having an expected molecular mass of ~ 35.6 kDa as determined by MS. However due to enlarged hydrodymanic volume recombinant mouse pegylated leptin runs on the SDS-PAGE as 48 kDa protein and in gel-filtration on Superdex 200 as over 100 kDa protein. Recombinant human pegylated leptin half-life in circulation after SC injection was over 20 hours. Recombinant human leptin was purified by proprietary chromatographic techniques according to Salomon et al (2006) Protein Expression and Purification 47, 128-136 and then pegylated.
- Formulation:
- lyophilized
- Molecular Weight:
- 35.6 kDa
- Purity:
- > 98.0% as determined by Gel filtration and SDS-PAGE gel.
- Reactivities:
- Human
- Sequence:
- AVPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC
- Shipping Conditions:
- Blue Ice
- Supplier:
- ReliaTech
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
