Lactogen, placental
Product Sizes
1000 ug
£4421.00
500-035-L1000-1000UG
About this Product
- SKU:
- 500-035-L1000
- Additional Names:
- Chorionic somatomammotropin hormone 1, Choriomammotropin, Placental lactogen (PL)
- Extra Details:
- Recombinant human placental lactogen, one polypeptide chain containing 199 amino and an additional Ala at N-terminus acids and having a molecular mass of ~ 22.4 kDa, was purified by proprietary chromatographic techniques.
- Formulation:
- lyophilized
- Molecular Weight:
- 22.4 kDa
- Purity:
- > 98.0% as determined by Gel filtration and SDS-PAGE gel.
- Reactivities:
- Human
- Sequence:
- AVQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEETYIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF
- Shipping Conditions:
- Blue Ice
- Supplier:
- ReliaTech
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
