IGF-1
Product Sizes
10 ug
£286.00
500-025-10UG
50 ug
£403.00
500-025-50UG
About this Product
- SKU:
- 500-025
- Additional Names:
- Igf1; Igf-1; Igf-I; C730016P09Rik
- translate.label.attr.clone:
- (#8M79)
- Extra Details:
- IGF-1 is a small protein secreted mainly but not solely by the liver and circulating in blood mostly as a complex with various IGF binding proteins in the blood. It has growth-regulating, insulin-like, and mitogenic activities and it is secreted in response to growth hormone stimulation. Recombinant rat IGF-I produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 71 amino acids and having a molecular mass of 7.6 kDa.
- Formulation:
- lyophilized
- Host:
- Mouse
- Molecular Weight:
- 7.6 kDa
- Purity:
- >98.0% as determined by SDS-PAGE
- Reactivities:
- Rat
- Sequence:
- MGPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKSA
- Shipping Conditions:
- Ambient
- Storage Conditions:
- Room Temperature
- Supplier:
- ReliaTech
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
