Growth Hormone
Product Sizes
1000 ug
£3089.00
500-017-L1000-1000UG
About this Product
- SKU:
- 500-017-L1000
- Additional Names:
- Somatotropin, GH, GH-N, Growth Hormone 1, Pituitary growth hormone
- Extra Details:
- Recombinant rat GH-22K produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 192 amino acids and having a molecular mass of 22367 Dalton.
- Formulation:
- lyophilized
- Molecular Weight:
- 22.3 kda
- Purity:
- > 98.0% as determined by Gel filtration and SDS-PAGE gel.
- Sequence:
- AAFPAMPLSSLFANAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSETIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDLEEGIQALMQELEDGSPRIGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYLRVMKCRRFAESSCAF
- Shipping Conditions:
- Blue Ice
- Supplier:
- ReliaTech
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
