Growth Hormone Receptor (hGH binding protein), soluble
Product Sizes
100 ug
£647.00
500-016-100UG
50 ug
£674.00
500-016-50UG
About this Product
- SKU:
- 500-016
- Additional Names:
- Somatotropin, GH, GH-N, Growth Hormone 1, Pituitary growth hormone
- Extra Details:
- Recombinant rbGHBP, one polypeptide chain containing 248 amino acids and having a molecular mass of ~ 28 kDa, Rabbit GHBP was purified by proprietary chromatographic techniques, (see Sakal et al. Prep Biochem Biotechnol. 30:107-23, 2000).
- Formulation:
- lyophilized
- Host:
- E. coli
- Molecular Weight:
- 28.0 kDa
- Purity:
- > 98.0% as determined by Gel filtration and SDS-PAGE gel.
- Sequence:
- AFSGSEATPATLGRASESVQRVHPGLGTNSSGKPKFTKCRSPELETFSCHWTDGVHHGLKSPGSVQLFYIRRNTQEWTQEWKECPDYVSAGENSCYFNSSYTSIWIPYCIKLTNNGGMVDQKCFSVEEIVQPDPPIGLNWTLLNVSLTGIHADIQVRWEPPPNADVQKGWIVLEYELQYKEVNETQWKMMDPVLSTSVPVYSLRLDKEYEVRVRSRQRSSEKYGEFSEVLYVTLPQMSPFTCEEDFRF
- Shipping Conditions:
- Ambient
- Storage Conditions:
- Room Temperature
- Supplier:
- ReliaTech
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins