Growth Hormone Receptor (hGH binding protein), soluble
Product Sizes
5 ug
£286.00
500-014-5UG
20 ug
£403.00
500-014-20UG
About this Product
- SKU:
- 500-014
- Additional Names:
- Somatotropin, GH, GH-N, Growth Hormone 1, Pituitary growth hormone
- Extra Details:
- Recombinant oGHBP, one polypeptide chain containing 244 amino acids and having a molecular mass of ~ 28 kDa, hGHBP was purified by proprietary chromatographic techniques, (see Herman et al. J Biol Chem. (1999) 274, 7631-9.
- Formulation:
- lyophilized
- Molecular Weight:
- 28.0 kDa
- Purity:
- > 98.0% as determined by Gel filtration and SDS-PAGE gel.
- Sequence:
- AFSGSEATPAFFVRASQSLQILYPGLETNSSGNLKFTKCRSPELETFSCHWTDGANHSLQSPGSVQMFYIRRDIQEWKECPDYVSAGENSCYFNSSYTSVWTPYCIKLTSNGGIVDHKCFSVEDIVQPDPPVGLNWTLLNISLTEIHADILVKWEPPPNTDVKMGWIILEYELHYKELNETQWKMMDPLLVTSVPMYSLRLDKEYEVRVRTRQRNTEKYGKFSEVLLITFPQMNPSACEEDFQF
- Shipping Conditions:
- Ambient
- Supplier:
- ReliaTech
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
