FGF-21
Product Sizes
1000 ug
£5952.00
500-003-L1000-1000UG
About this Product
- SKU:
- 500-003-L1000
- Additional Names:
- Fibroblast Growth Factor-21, FGFL
- Extra Details:
- Bovine FGF-21 is a secreted growth factor that is a member of the FGF family. Proteins of this family play a central role during prenatal development and postnatal growth and regeneration of a variety of tissues, by promoting cellular proliferation and differentiation. Recombinant bovine FGF-21 is a 19.5 kDa protein containing 182 amino acid residues.
- Formulation:
- lyophilized
- Molecular Weight:
- 19.5 kDa
- Purity:
- > 98% by SDS-PAGE & gel filtration
- Reactivities:
- Bovine
- Sequence:
- AHPIPDSSPLLQFGGQVRQRYLYTDDAQETEAHLEIRADGTVVGAARQSPESLLELKALKPGVIQILGVKTSRFLCQGPDGKLYGSLHFDPKACSFRELLLEDGYNVYQSETLGLPLRLPPQRSSNRDPAPRGPARFLPLPGLPAAPPDPPGILAPEPPDVGSSDPLSMVGPSYGRSPSYTS
- Shipping Conditions:
- Blue Ice
- Supplier:
- ReliaTech
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
