FGF-4
Product Sizes
25 ug
£270.59
300-131-25UG
About this Product
- SKU:
- 300-131
- Additional Names:
- FGF4; HST; KFGF; HST-1; HSTF1; K-FGF; HBGF-4
- Buffer:
- PBS
- translate.label.attr.clone:
- (#10V5)
- Extra Details:
- FGF-4 (fibroblast growth factor 4), also known as K-FGF (Kaposi's sarcoma associated FGF), is a 25 kDa secreted, heparin binding member of the FGF family. The human FGF-4 cDNA encodes 206 amino acids (aa) with a 33 aa signal sequence and a 173 aa mature protein with an FGF homology domain that contains a heparin binding region near the C terminus. Mature human FGF-4 shares a high aa identity with mouse, rat, canine and bovine FGF-4, respectively. The expression of FGF-4 and its receptors, FGF-R1c, -R2c, -R3c and R4, is spatially and temporally regulated during embryonic development. Its expression in the mouse trophoblast inner cell mass promotes expression of FGF-R2, and is required for maintenance of the trophectoderm and primitive endoderm. FGF-4 is proposed to play a physiologically relevant role in human embryonic stem cell self-renewal. It promotes stem cell proliferation, but may also aid differentiation depending on context and concentration, and is often included in embryonic stem cell media in-vitro. FGF-4 is mitogenic for fibroblasts and endothelial cells in-vitro and has autocrine transforming potential. It is a potent angiogenesis promoter in-vivo and has been investigated as therapy for coronary artery disease.
- Formulation:
- lyophilized
- Host:
- Rat
- Molecular Weight:
- 19.7 kDa
- Purity:
- >95%
- Reactivities:
- Human, Mouse, Porcine, Rat
- Sequence:
- APTAPNGTLEAELERRWESLVALSLARLPVAAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLP RL
- Shipping Conditions:
- Ambient
- Storage Conditions:
- -20[o]C reconstituted, working aliquot. Avoid freeze/thaw cycles.
- Supplier:
- ReliaTech
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins