IL-4
Product Sizes
10 ug
£204.71
200-022-10UG
About this Product
- SKU:
- 200-022
- Additional Names:
- IL4; BSF1; IL-4; BCGF1; BSF-1; BCGF-1
- Buffer:
- PBS
- translate.label.attr.clone:
- (#7H26)
- Extra Details:
- IL-4 is a pleiotropic cytokine that regulates diverse T and B cell responses including cell proliferation, survival and gene expression. Produced by mast cells, T cells and bone marrow stromal cells, IL-4 regulates the differentiation of naive CD4+ T cells into helper Th2 cells, characterized by their cytokine-secretion profile that includes secretion of IL-4, IL-5, IL-6, IL-10, and IL-13, which favor a humoral immune response. Another dominant function of IL-4 is the regulation of immunoglobulin class switching to the IgG1 and IgE isotypes. Excessive IL-4 production by Th2 cells has been associated with elevated IgE production and allergy. Recombinant human IL-4 is a 14.9 kDa globular protein containing 130 amino acid residues
- Formulation:
- lyophilized
- Host:
- E. coli
- Molecular Weight:
- 14.9 kDa
- Purity:
- >98%
- Reactivities:
- Human
- Sequence:
- MHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS
- Shipping Conditions:
- Ambient
- Storage Conditions:
- Room Temperature
- Supplier:
- ReliaTech
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins