IL-36RA
Product Sizes
250 ug
£1827.00
100-414-L250-250UG
About this Product
- SKU:
- 100-414-L250
- Additional Names:
- FIL1 delta, IL-1F5, IL-1HY1, IL-1L1, IL-1RP3, IL-1ra homolog 1, IL-1 delta
- Extra Details:
- The IL-1 family is comprised of 11 structurally related ligands, including the recently re-named IL-36RA (IL-1F5), IL-36A Alpha (IL-1F6), IL-36B Beta (IL-1F8), and IL-36G Gamma (IL-1F9). The interaction of IL-36 ligands with the IL-1Rrp2 receptor (IL-1R6) can induce various activities, including dendritic cell maturation and activation. IL-36RA can antagonize the NF-kappaB signaling induced by either IL-36A Alpha, -B Beta or -G Gamma by binding to the IL-1Rrp2 receptor in a manner that prevents the initiation of functional signaling. Recombinant human IL-36RA is an E. coli derived 17 kDa protein containing 154 amino acid residues.
- Formulation:
- lyophilized
- Molecular Weight:
- 17 kDa
- Purity:
- > 98% by SDS-PAGE & HPLC analyses
- Reactivities:
- Human
- Sequence:
- VLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSCGVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCD
- Shipping Conditions:
- Blue Ice
- Supplier:
- ReliaTech
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
