Mouse anti Integrin alpha 3B (CD49c)
Product Sizes
0.1 mg
£417.00
NM-MUB0902P-0.1MG
About this Product
- SKU:
- NM-MUB0902P
- Application:
- IHC-Frozen, Immunocytochemistry, Western Blot
- CE/IVD:
- RUO
- translate.label.attr.clone:
- 54B3
- Clonality:
- Monoclonal
- Extra Details:
- MUbio
- Format:
- Each vial contains 100 ul 1 mg/ml purified monoclonal antibody in PBS containing 0.09% sodium azide.
- Formulation:
- Each vial contains 100 ul 1 mg/ml purified monoclonal antibody in PBS containing 0.09% sodium azide.
- Host:
- Mouse
- Isotype:
- IgG1
- Reactivities:
- Human
- Shipping Conditions:
- Ambient
- Specificity:
- 54B3 recognizes specifically the cytoplasmic domain of integrin subunit A Alpha3B which is present in microvascular structures in brain and heart.
- Source:
- 54B3 is a Mouse monoclonal IgG1 antibody derived by fusion of SP2/0 Mouse myeloma cells with spleen cells from a BALB/c Mouse immunized with a synthetic peptide corresponding to a 32 amino acid stretch in the cytoplasmic domain of integrin A Alpha3B including an appending N-terminal cysteine (CTRYYQIMPKYHAVRIREEERYPPPGSTLPTKK) coupled to keyhole limpet hemocyanin.
- Storage Conditions:
- Please refer to datasheet
- Supplier:
- Nordic-MUbio
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:MUB0902P
