Mouse anti Integrin alpha 3A
Product Sizes
0.1 mg
£417.00
NM-MUB0900P-0.1MG
About this Product
- SKU:
- NM-MUB0900P
- Application:
- IHC-Frozen, Immunocytochemistry, Western Blot
- CE/IVD:
- RUO
- translate.label.attr.clone:
- 29A3
- Clonality:
- Monoclonal
- Extra Details:
- MUbio
- Format:
- Each vial contains 100 ul 1 mg/ml purified monoclonal antibody in PBS containing 0.09% sodium azide.
- Formulation:
- Each vial contains 100 ul 1 mg/ml purified monoclonal antibody in PBS containing 0.09% sodium azide.
- Host:
- Mouse
- Isotype:
- IgG1
- Reactivities:
- Human
- Shipping Conditions:
- Ambient
- Specificity:
- 29A3 recognizes specifically the cytoplasmic domain of integrin subunit A Alpha3A which is present in the basal cell layer in skin, glomeruli, Bowman's capsules and distal tubuli in kidney, all vascular and capillary endothelia in brain, heart and skin, and vascular smooth muscle cells in heart.
- Source:
- 29A3 is a Mouse monoclonal IgG1, K Kappa antibody derived by fusion of SP2/0 Mouse myeloma cells with spleen cells from a BALB/c Mouse immunized with a synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit A Alpha3A including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin.
- Storage Conditions:
- Please refer to datasheet
- Supplier:
- Nordic-MUbio
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:MUB0900P
