TLR10 Antibody (aa81-111)
Product Sizes
200 ug
£ POA
LS-C83991-200UG
About this Product
- SKU:
- LS-C83991
- Additional Names:
- TLR10, CD290, CD290 antigen, Toll-like receptor 10
- Application:
- Immunocytochemistry, Immunohistochemistry, Western Blot
- Buffer:
- PBS, 1 mg/ml BSA, 0.1% Sodium Azide
- Clonality:
- Polyclonal
- Host:
- Goat
- Immunogen:
- 31 AA (aa) synthetic peptide C-HNRIQQLDLKTFEFNKELRYLDLSNNRLKSV corresponding to aa 81-111 of the N-Terminus domain of Human TLR10. Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon (100%); Orangutan, Monkey (97%); Marmoset (94%); Sheep, Goat, Zebu, Bovine (87%); Elephant, Horse (84%); Panda, Pig (81%).
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Shipping Conditions:
- Ambient
- Specificity:
- Peptide sequence is <50 % identical to other human TLR receptors in this region. The antibody recognizes human TLR10.
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:84890
