TLR8 Antibody (aa81-109)
Product Sizes
200 ug
£ POA
LS-C83989-200UG
About this Product
- SKU:
- LS-C83989
- Additional Names:
- TLR8, CD288, Toll-like receptor 8, CD288 antigen
- Application:
- Immunocytochemistry, Western Blot
- Buffer:
- PBS, 1 mg/ml BSA, 0.1% Sodium Azide
- Clonality:
- Polyclonal
- Host:
- Goat
- Immunogen:
- 30 AA (aa)synthetic peptide C-ESFQGLQNLTKINLNHNPNVQHQNGNPGI corresponding to aa 81-109 of the N-Terminus domain of Human TLR8. Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon (100%); Monkey (93%); Marmoset (86%).
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Shipping Conditions:
- Ambient
- Specificity:
- Peptide sequence is <50 % identical to other human TLR receptors in this region. The antibody recognizes human TLR8 and mouse TLR8.
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:84888
