TLR4 Antibody (aa161-192)
Product Sizes
200 ug
£ POA
LS-C83988-200UG
About this Product
- SKU:
- LS-C83988
- Additional Names:
- TLR4, CD284, CD284 antigen, Homolog of Drosophila toll, TLR-4, TOLL, ARMD10, Toll-like receptor 4, HToll
- Application:
- Immunocytochemistry, Western Blot
- Buffer:
- PBS, 1 mg/ml BSA, 0.1% Sodium Azide
- Clonality:
- Polyclonal
- Host:
- Goat
- Immunogen:
- Synthetic peptide LIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYC corresponding to aa 161-192 of the N-Terminus domain of Human TLR4. Percent identity by BLAST analysis: Human, Chimpanzee, Orangutan, Gibbon (100%); Gorilla, Baboon, Monkey (97%); Marmoset (94%); Hamster (87%); Sheep, Goat, Zebu, Bovine (84%); Rat, Dolphin, Panda, Bat, Cat, Pig (81%).
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Shipping Conditions:
- Ambient
- Specificity:
- Peptide sequence is <50 % identical to other human TLR receptors in this region. The antibody recognizes human TLR4, mouse, and rat TLR4.
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:84887
