IL-22BP / IL22RA2 Antibody (aa33-60)
Product Sizes
200 ug
£ POA
LS-C83979-200UG
About this Product
- SKU:
- LS-C83979
- Additional Names:
- IL22RA2, Class II cytokine receptor, IL-22BP, IL-22RA2, IL-22R-alpha-2, Interleukin 22-binding protein, Interleukin-22-binding protein, CRF2-10, CRF2-S1, CRF2X, IL-22 receptor subunit alpha-2, IL22BP, ZcytoR16
- Application:
- ELISA
- Buffer:
- 10mM KHPO4, 140mM NaCl, 1mg/ml BSA, 0.1% sodium azide
- Clonality:
- Polyclonal
- Host:
- Goat
- Immunogen:
- Synthetic peptide RVQFQSRNFHNILQWQPGRALTGNSSVY-C corresponding to 33-60 residues of N-Terminus of human IL-22R-alpha-2 protein with cysteine added for conjugation to a carrier protein. Percent identity by BLAST analysis: Human, Gorilla, Monkey (100%); Gibbon (96%); Marmoset (89%); Dog (82%).
- Purification:
- Affinity Purified
- Reactivities:
- Human, Non-human Primate
- Shipping Conditions:
- Ambient
- Specificity:
- This antibody recognizes the N-terminus region of human interleukin-22 receptor alpha-2 chain precursor (IL-22R-alpha-2) which is also known as IL-22-binding protein (IL22BP), cytokine receptor family class II member 10 (CRF2-10), and cytokine receptor family type 2, soluble 1 (CRF2-S1). This antibody is likely to recognize rat and mouse IL-22 RA2 protein due to sequence similarity. The peptide se
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:84878
