IL21 Receptor Antibody (aa35-64)
Product Sizes
200 ug
£ POA
LS-C83977-200UG
About this Product
- SKU:
- LS-C83977
- Additional Names:
- IL21R, CD360, Interleukin 21 receptor, Interleukin-21 receptor, NILR, IL-21 receptor, CD360 antigen, IL-21R, IL21 Receptor, Novel interleukin receptor
- Application:
- ELISA, Flow Cytometry, Immunohistochemistry
- Buffer:
- 10 mM Potassium Phosphate, 140 mM NaCl, 1 mg/ml BSA, 0.1% Sodium Azide
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide CVLETRSPNPSILSLTWQDEYEELQDQETF corresponding to 35-65 residues of N-Terminus of mouse IL-21 receptor. Percent identity by BLAST analysis: Mouse (100%); Rat (90%).
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Shipping Conditions:
- Ambient
- Specificity:
- Peptide sequence is <50 % identical to other sequences in GenBank. The antibody recognizes mouse IL-21 receptor. Not tested for cross-reactivity to human IL-21 receptor.
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:84876
