TLR5 Antibody (aa151-181)
Product Sizes
200 ug
£ POA
LS-C83963-200UG
About this Product
- SKU:
- LS-C83963
- Additional Names:
- TLR5, TIL3, Toll-like receptor 5, SLEB1
- Application:
- ELISA, Flow Cytometry, Immunocytochemistry, Immunohistochemistry, Western Blot
- Buffer:
- PBS, 1 mg/ml BSA, 0.1% Sodium Azide
- Clonality:
- Polyclonal
- Host:
- Goat
- Immunogen:
- Synthetic peptide DLSKNQIRSLYLHPSFGKLNSLKSIDFSSNQ corresponding to aa 151-181 of human TLR5. Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Macaque, Monkey, Spider monkey, Siamang (100%); Colobus monkey, Baboon (97%); Marmoset (94%); Sheep, Goat, Panda, Water buffalo (84%); Zebu, Bovine (81%).
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Shipping Conditions:
- Ambient
- Specificity:
- Peptide sequence is <50 % identical to other human TLR receptors in this region. The antibody recognizes human TLR5 and was not tested for cross-reactivity to mouse TLR5.
- Storage Conditions:
- -70[o]C Avoid freeze/thaw cycles., -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:84862
