BTLA / CD272 Antibody
Product Sizes
100 ug
£ POA
LS-C782854-100UG
About this Product
- SKU:
- LS-C782854
- Additional Names:
- BTLA, BTLA1, B and T lymphocyte associated, CD272, B and T lymphocyte attenuator, B- and T-lymphocyte attenuator, CD272 antigen
- Application:
- Western Blot
- Buffer:
- Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Amino acids QSNLIESHSTTLYVTDVKSASERPSKDEMASRPWLLYRL were used as the immunogen for the CD272 antibody.
- Isotype:
- IgG
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse
- Shipping Conditions:
- Ambient
- Storage Conditions:
- 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles., -20[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:809384
