PMEL / SILV / gp100 Antibody
Product Sizes
100 ug
£ POA
LS-C782847-100UG
About this Product
- SKU:
- LS-C782847
- Additional Names:
- PMEL, gp100, Melanocyte protein PMEL, Me20m/me20s, p100, PMEL17, Premelanosome protein, SIL, Silver homolog (mouse), Silver, mouse, homolog of, Silver locus protein homolog, ME20-M, Me20-m/me20-s, ME20M, Melanocyte protein mel 17, Melanocyte protein Pmel 17, Silver (mouse homolog) like, D12S53E, ME20, Melanosomal matrix protein17, SILV
- Application:
- Western Blot
- Buffer:
- Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Amino acids KVPRNQDWLGVSRQLRTKAWNRQLYPEWTEAQRLD were used as the immunogen for the PMEL17 antibody.
- Isotype:
- IgG
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Mouse, Rat
- Shipping Conditions:
- Ambient
- Storage Conditions:
- 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles., -20[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:809377
