GSTM1 Antibody
Product Sizes
100 ug
£ POA
LS-C782843-100UG
About this Product
- SKU:
- LS-C782843
- Additional Names:
- GSTM1, Glutathione S-aryltransferase, GSTM1-1, GSTM1a-1a, GSTM1b-1b, Glutathione S-alkyltransferase, GTH4, GST class-mu 1, GST1, GTM1, H-B, HB subunit 4, MU-1, Glutathione S-transferase M1, Glutathione S-transferase mu 1, GST HB subunit 4
- Application:
- Western Blot
- Buffer:
- Lyophilized from PBS, 2% Trehalose, 0.025% sodium azide
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Amino acids EEEKIRVDILENQTMDNHMQLGMICYNPEFEKLK from the human protein were used as the immunogen for the GSTM1 antibody.
- Isotype:
- IgG
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Mouse, Rat
- Shipping Conditions:
- Ambient
- Storage Conditions:
- 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles., -20[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:809373
