IFNAR1 / IFNAR Antibody
Product Sizes
100 ug
£ POA
LS-C782783-100UG
About this Product
- SKU:
- LS-C782783
- Additional Names:
- IFNAR1, Alpha-type antiviral protein, Beta-type antiviral protein, CRF2-1, IFN-alpha/beta receptor 1, IFN-alpha-REC, IFN-R-1, IFNAR, IFNBR, IFRC, Interferon-beta receptor 1, Interferon-alpha receptor, Type I interferon receptor 1
- Application:
- Western Blot
- Buffer:
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Amino acids 263-306 (HAFLKRNPGNHLYKWKQIPDCENVKTTQCVFPQNVFQKGIYLLR) from the human protein were used as the immunogen for the IFNAR1 antibody.
- Isotype:
- IgG
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse
- Shipping Conditions:
- Ambient
- Storage Conditions:
- 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles., -20[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:809313
