ANXA8 / Annexin A8 Antibody
Product Sizes
100 ug
£ POA
LS-C782781-100UG
About this Product
- SKU:
- LS-C782781
- Additional Names:
- ANXA8, Annexin A8, Annexin-8, ANX8, Vascular anticoagulant-beta, Annexin VIII, VAC-beta
- Application:
- Western Blot
- Buffer:
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Amino acids 20-61 (HFNPDPDAETLYKAMKGIGTNEQAIIDVLTKRSNTQRQQIAK) from the human protein were used as the immunogen for the Annexin VIII antibody.
- Isotype:
- IgG
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Shipping Conditions:
- Ambient
- Storage Conditions:
- 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles., -20[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:809311
