Peptide YY / PYY Antibody
Product Sizes
100 ug
£ POA
LS-C782268-100UG
About this Product
- SKU:
- LS-C782268
- Additional Names:
- PYY, Peptide tyrosine tyrosine, PYY1, Peptide YY, PYY-I
- Application:
- IHC-Paraffin
- Buffer:
- Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Amino acids YPIKPEAPREDASPEELNRYYASLRHYLNLVTRQRY were used as the immunogen for the Peptide YY antibody.
- Isotype:
- IgG
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Mouse, Rat
- Shipping Conditions:
- Ambient
- Storage Conditions:
- 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles., -20[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:808796
