TGFB2 / TGF Beta2 Antibody
Product Sizes
100 ug
£ POA
LS-C782146-100UG
About this Product
- SKU:
- LS-C782146
- Additional Names:
- TGFB2, BSC-1 cell growth inhibitor, Cetermin, G-TSF, LDS4, Polyergin, TGF-beta-2, TGF Beta2, TGF-beta2
- Application:
- Western Blot
- Buffer:
- Lyophilized from PBS, 2% Trehalose, 0.025% sodium azide
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Amino acids ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPK were used as the immunogen for the TGFB2 antibody.
- Isotype:
- IgG
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Shipping Conditions:
- Ambient
- Storage Conditions:
- 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles., -20[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:808674
