L1CAM Antibody
Product Sizes
100 ug
£ POA
LS-C782087-100UG
About this Product
- SKU:
- LS-C782087
- Additional Names:
- L1CAM, CAML1, CD171 antigen, HSAS, HSAS1, MASA, MIC5, N-CAM-L1, N-CAML1, L1 cell adhesion molecule, NCAM-L1, S10, SPG1, CD171
- Application:
- IHC-Paraffin
- Buffer:
- Lyophilized from PBS, 2% Trehalose, 0.025% sodium azide
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Amino acids NMVITWKPLRWMDWNAPQVQYRVQWRPQGTRGPW were used as the immunogen for the L1CAM antibody.
- Isotype:
- IgG
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Shipping Conditions:
- Ambient
- Storage Conditions:
- 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles., -20[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:808615
