ACE / CD143 Antibody
Product Sizes
100 ug
£ POA
LS-C782051-100UG
About this Product
- SKU:
- LS-C782051
- Additional Names:
- ACE, ACE1, Angiotensin-converting enzyme, CD143, CD143 antigen, Carboxycathepsin, DIPEPTIDYL CARBOXYPEPTIDASE, DCP, Dipeptidyl carboxypeptidase I, ICH, Kininase II, MVCD3, Peptidyl-dipeptidase A, Peptidase P, DCP1, Dipeptidyl carboxypeptidase 1, Testicular ECA
- Application:
- Western Blot
- Buffer:
- Lyophilized from PBS, 2% Trehalose, 0.025% sodium azide
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Amino acids AMMNYFKPLTEWLVTENRRHGETLGWPEYNWAPNTAR from the mouse protein were used as the immunogen for the Ace antibody.
- Isotype:
- IgG
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Mouse, Rat
- Shipping Conditions:
- Ambient
- Storage Conditions:
- 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles., -20[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:808579
