CD119 / IFNGR1 Antibody
Product Sizes
100 ug
£ POA
LS-C781958-100UG
About this Product
- SKU:
- LS-C781958
- Additional Names:
- IFNGR1, AVP, type 2, Antiviral protein, type 2, CD119, CD119 antigen, IFNGR, IFN-gamma receptor 1, IFN-gamma-R1, Immune interferon receptor 1, Interferon gamma receptor 1, CDw119
- Application:
- Western Blot
- Buffer:
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Amino acids 108-147 (QKESAYAKSEEFAVCRDGKIGPPKLDIRKEEKQIMIDIFH) from the human protein were used as the immunogen for the CD119 antibody.
- Isotype:
- IgG
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Shipping Conditions:
- Ambient
- Storage Conditions:
- 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles., -20[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:808486
