KDM5B / JARID1B Antibody
Product Sizes
100 ug
£ POA
LS-C781873-100UG
About this Product
- SKU:
- LS-C781873
- Additional Names:
- KDM5B, CT31, JARID1B, Histone demethylase JARID1B, RBBP2H1A, Lysine-specific demethylase 5B, PUT1, RBP2-H1, Cancer/testis antigen 31, PLU-1, PLU1, RBBP2H1
- Application:
- Western Blot
- Buffer:
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Amino acids 641-685 (DVLDVVVASTVQKDMAIMIEDEKALRETVRKLGVIDSERMDFELL) from the human protein were used as the immunogen for the KDM5B antibody.
- Isotype:
- IgG
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Shipping Conditions:
- Ambient
- Storage Conditions:
- 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles., -20[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:808401
