AICDA / AID Antibody (Biotin)
Product Sizes
100 ul
£ POA
LS-C761216-100UL
About this Product
- SKU:
- LS-C761216
- Additional Names:
- AICDA, AID, ARP2, CDA2, Cytidine aminohydrolase, HIGM2
- Application:
- Immunohistochemistry
- Buffer:
- PBS, 0.09% sodium azide, 2% sucrose
- Clonality:
- Polyclonal
- Conjugate:
- Biotin
- Host:
- Rabbit
- Immunogen:
- The immunogen is a synthetic peptide directed towards the following sequence VKRRDSATSFSLDFGYLRNKNGCHVELLFLRYISDWDLDPGRCYRVTWFT
- Purification:
- Affinity Purified
- Reactivities:
- Canine, Horse, Human, Mouse, Porcine, Rabbit, Rat
- Shipping Conditions:
- Ambient
- Storage Conditions:
- 2-8[o]C Aliquot. Avoid freeze/thaw cycles., -20[o]C Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:787067
