KRT19 / CK19 / Cytokeratin 19 Antibody
Product Sizes
100 ug
£ POA
LS-C756650-100UG
About this Product
- SKU:
- LS-C756650
- Additional Names:
- KRT19, CK19, Cytokeratin 19, Cytokeratin-19, Keratin 19, Keratin-19, CK-19, K19, K1CS, Keratin, type I, 40-kd
- Application:
- IHC-Paraffin, Immunofluorescence, Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Clonality:
- Monoclonal
- Host:
- Mouse
- Immunogen:
- A synthetic peptide corresponding to a sequence at the C-Terminus of human Cytokeratin 19 (334-372 aa QLAHIQALISGIEAQLGDVRADSERQNQEYQRLMDIKSR), different from the related mouse and rat sequences by nine amino acids.
- Isotype:
- IgG1
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Shipping Conditions:
- Ambient
- Specificity:
- No cross reactivity with other proteins.
- Storage Conditions:
- 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles., -20[o]C Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:782334
