HSPA1A Antibody
Product Sizes
100 ug
£ POA
LS-C756640-100UG
About this Product
- SKU:
- LS-C756640
- Additional Names:
- HSPA1A, Heat shock 70kDa protein 1A, Heat shock 70 kDa protein 1/2, Heat shock 70kD protein 1A, HSP70-1/HSP70-2, HSPA1, HSP70-1A, Heat shock 70 kd protein 1, Heat shock-induced protein, Iroquois homeobox protein 4, HSP70-1, Hsp70.1, HSP70.1/HSP70.2, HSP70I, HSP72
- Application:
- Flow Cytometry, IHC-Frozen, IHC-Paraffin, Immunocytochemistry, Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Clonality:
- Monoclonal
- Host:
- Mouse
- Immunogen:
- A synthetic peptide corresponding to a sequence at the C-Terminus of human Hsp70 (559-596 aa KGKISEADKKKVLDKCQEVISWLDANTLAEKDEFEHKR), different from the related mouse sequence by five amino acids, and from the related rat sequence by three amino acids.
- Isotype:
- IgG1
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Shipping Conditions:
- Ambient
- Specificity:
- No cross reactivity with other proteins.
- Storage Conditions:
- 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles., -20[o]C Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:782324
