EMD / Emerin Antibody
Product Sizes
100 ug
£ POA
LS-C756632-100UG
About this Product
- SKU:
- LS-C756632
- Additional Names:
- EMD, EDMD, Emerin, LEM domain containing 5, LEMD5, STA
- Application:
- Flow Cytometry, IHC-Frozen, IHC-Paraffin, Immunocytochemistry, Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Clonality:
- Monoclonal
- Host:
- Mouse
- Immunogen:
- A synthetic peptide corresponding to a sequence at the N-Terminus of human Emerin (1-48 aa MDNYADLSDTELTTLLRRYNIPHGPVVGSTRRLYEKKIFEYETQRRRL), different from the related mouse sequence by eight amino acids, and from the related rat sequence by nine amino acids.
- Isotype:
- IgG1
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Shipping Conditions:
- Ambient
- Specificity:
- No cross reactivity with other proteins.
- Storage Conditions:
- 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles., -20[o]C Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:782316
