ATF4 Antibody
Product Sizes
100 ug
£ POA
LS-C756394-100UG
About this Product
- SKU:
- LS-C756394
- Additional Names:
- ATF4, CREB-2, CREB2, TXREB, DNA-binding protein TAXREB67, TAXREB67
- Application:
- IHC-Paraffin, Western Blot
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence of human ATF4 (KELEKKNEALKERADSLAKEIQYLKDLIEEVRKARGKKRVP).
- Isotype:
- IgG
- Physical State:
- Lyophilized
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Shipping Conditions:
- Ambient
- Specificity:
- No cross reactivity with other proteins.
- Storage Conditions:
- 2-8[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles., -20[o]C Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:782078
