BCL2 / Bcl-2 Antibody (DY488)
Product Sizes
100 ug
£ POA
LS-C756362-100UG
About this Product
- SKU:
- LS-C756362
- Additional Names:
- BCL2, Apoptosis regulator Bcl-2, B-cell CLL/lymphoma 2, B-cell lymphoma protein 2, Bcl-2, PPP1R50
- Application:
- Flow Cytometry
- Buffer:
- 0.2% Na2HPO40.9% NaCl, 0.02% sodium azide, 50% glycerol
- Clonality:
- Polyclonal
- Conjugate:
- DyLight™ 488
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence in the middle region of human Bcl-2 (102-140 aa DDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRD), identical to the related mouse and rat sequences.
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Shipping Conditions:
- Ambient
- Specificity:
- No cross reactivity with other proteins.
- Storage Conditions:
- 2-8[o]C Do not freeze. Protect from light.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:782046
