RBM8A / Y14 Antibody
Product Sizes
100 ul
£ POA
LS-C750098-100UL
20 ul
£ POA
LS-C750098-20UL
About this Product
- SKU:
- LS-C750098
- Additional Names:
- RBM8A, Binder of OVCA1-1, BOV-1A, C1DELq21.1, BOV-1B, BOV-1, DEL1q21.1, MDS014, Ribonucleoprotein RBM8A, Ribonucleoprotein RBM8, RNA-binding motif protein 8A, RNA-binding protein Y14, TAR, Y14, ZRNP1, RBM8, RBM8B, RNA binding motif protein 8, RNA binding motif protein 8A, RNA-binding protein 8A, BOV-1C, ZNRP, RNA binding motif protein 8B
- Application:
- Western Blot
- Buffer:
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human RBM8A (NP_005096.1). MADVLDLHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDSVEQDGDEPGPQRSVEGWILFVTGV
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Shipping Conditions:
- Ambient
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:775695
