GYPB / CD235b / Glycophorin B Antibody
Product Sizes
100 ul
£ POA
LS-C750036-100UL
20 ul
£ POA
LS-C750036-20UL
About this Product
- SKU:
- LS-C750036
- Additional Names:
- GYPB, Glycophorin-B, GPB, GPB.NY, GYPHe.NY, Glycophorin B (Ss blood group), Glycophorin b precursor, Glycophorin MiIII, HGpMiX, Glycophorin HeP2, Glycophorin MiVI, GpMiIII, HGpMiIII, Sialoglycoprotein delta, SS, PAS-3, SS-active sialoglycoprotein, CD235b, CD235b antigen, Glycophorin MiX, HGpMiVI, MNS, Ss blood group
- Application:
- Immunofluorescence
- Buffer:
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 1-91 of human GYPB (NP_002091.3). MYGKIIFVLLLSEIVSISALSTTEVAMHTSTSSSVTKSYISSQTNGETGQLVHRFTVPAPVVIILIILCVMAGIIGTILLISYTIRRLIKA
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Shipping Conditions:
- Ambient
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:775633
