BRAF / B-Raf Antibody
Product Sizes
100 ul
£ POA
LS-C750006-100UL
20 ul
£ POA
LS-C750006-20UL
About this Product
- SKU:
- LS-C750006
- Additional Names:
- BRAF, 94 kDa B-raf protein, B-raf, BRAF1, B Raf, Proto-oncogene B-Raf, p94, B-RAF1, NS7, ONCOGENE BRAF, RAFB1
- Application:
- Immunofluorescence, Immunohistochemistry, Western Blot
- Buffer:
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 350-449 of human BRAF (NP_004324.2). DEDHRNQFGQRDRSSSAPNVHINTIEPVNIDDLIRDQGFRGDGGSTTGLSATPPASLPGSLTNVKALQKSPGPQRERKSSSSSEDRNRMKTLGRRDSSDD
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Shipping Conditions:
- Ambient
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:775603
