AQP1 / Aquaporin 1 Antibody
Product Sizes
100 ul
£ POA
LS-C750004-100UL
20 ul
£ POA
LS-C750004-20UL
About this Product
- SKU:
- LS-C750004
- Additional Names:
- AQP1, Aquaporin-1, AQP-1, AQP-CHIP, Aquaporin 1, Aquaporin-CHIP, CHIP28, Colton blood group, Urine water channel, CO
- Application:
- Western Blot
- Buffer:
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence within amino acids 200 to the C-Terminus of human AQP1 (NP_932766.1). AVITHNFSNHWIFWVGPFIGGALAVLIYDFILAPRSSDLTDRVKVWTSGQVEEYDLDADDINSRVEMKPK
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Shipping Conditions:
- Ambient
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:775601
