DAP12 Antibody
Product Sizes
100 ul
£ POA
LS-C749774-100UL
20 ul
£ POA
LS-C749774-20UL
About this Product
- SKU:
- LS-C749774
- Additional Names:
- TYROBP, DNAX-activation protein 12, DAP12, PLOSL, KARAP, KAR-associated protein, PLO-SL
- Application:
- Western Blot
- Buffer:
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Clonality:
- Polyclonal
- Concentration:
- 1.23 mg/ml
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence within amino acids 50 to the C-Terminus of human TYROBP (NP_003323.1). DLVLTVLIALAVYFLGRLVPRGRGAAEAATRKQRITETESPYQELQGQRSDVYSDLNTQRPYYK
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Shipping Conditions:
- Ambient
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:775371
