APH1A / APH-1 Antibody
Product Sizes
100 ul
£ POA
LS-C749656-100UL
20 ul
£ POA
LS-C749656-20UL
About this Product
- SKU:
- LS-C749656
- Additional Names:
- APH1A, Aph-1alpha, APH-1, CGI-78, PSF, APH-1A, Gamma-secretase subunit APH-1A
- Application:
- Western Blot
- Buffer:
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence within amino acids 200 to the C-Terminus of human APH1A (NP_001071096.1). TSGLTFLNPWYEASLLPIYAVTVSMGLWAFITAGGSLRSIQRSLLCRRQEDSRVMVYSALRIPPED
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Shipping Conditions:
- Ambient
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:775253
